PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g030130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 605aa    MW: 68604.6 Da    PI: 5.7881
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g030130.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35047.2e-154484241353
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       +el+kr w+d+m+lkrlke+++  +   e  +++ k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv gasd+Lr+
  Sopen06g030130.1  48 DELEKRVWRDKMKLKRLKEMNQG-M---ED-VDSVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVGGASDNLRE 135
                       79******************997.5...54.7889********************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWk+kv+fdrngpaai+kyqa+++i+++++ ++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl
  Sopen06g030130.1 136 WWKDKVRFDRNGPAAIAKYQAEHAIPGKNEVSNP-VGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGQEDWWPQLGL 227
                       ***************************9999977.99******************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtl 276
                       +kdqg+ppykkphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++ s+  +s  +t+
  Sopen06g030130.1 228 QKDQGPPPYKKPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDrcPPlSSACGSGTFTV 320
                       *****************************************************************************863356666******* PP

                       XXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XX CS
              EIN3 277 sceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgset 339
                       ++++++dv+g +++   +vq++k ++                              +++++rkrk ++ e++ ++++  ++tc+  q+++se 
  Sopen06g030130.1 321 NDSSEYDVDGAQDECNFDVQEQKPHHlnllnvtverfnerlplqqqshpikdemitSLDFTRKRK-QSNEQTVTMAQ--IYTCEILQCPYSEL 410
                       *********99999999*******99**************************************9.56666666666..6************* PP

                       XXXXXXXXXXXXXX CS
              EIN3 340 elifadknsisqne 353
                       +++f+d++++++++
  Sopen06g030130.1 411 RHGFQDRSARDNHQ 424
                       ************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.6E-12848295No hitNo description
Gene3DG3DSA:1.10.3180.101.6E-75169305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.72E-62174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MMMFEEMGFC GDLDFFSAPL KEVEVAAPQT EAEQVVDDDY SDEDIDVDEL EKRVWRDKMK  60
LKRLKEMNQG MEDVDSVKQR QSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVGGAS DNLREWWKDK VRFDRNGPAA IAKYQAEHAI PGKNEVSNPV GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVS PPWWPTGQED WWPQLGLQKD QGPPPYKKPH  240
DLKKAWKVGV LTAVIKHISP DIAKIRKLVR QSKCLQDKMT AKESATWLAI INQEEALARE  300
LYPDRCPPLS SACGSGTFTV NDSSEYDVDG AQDECNFDVQ EQKPHHLNLL NVTVERFNER  360
LPLQQQSHPI KDEMITSLDF TRKRKQSNEQ TVTMAQIYTC EILQCPYSEL RHGFQDRSAR  420
DNHQLACPYR NTSQFGVSKF PMNEVKPVVF PQQYAPSTAV ALPVNPSPPP FDLFGVGVPE  480
DGQRMIDDLM SFYDCNIQGN KSQNTGNVAV TKEQQPHQQP HVDQVNYLHS RGMMDGNIFK  540
DVNVSASQSM QPQGNLVDQC KILNSSDNLH FMFGTPFNLQ STNYPGSLPG IGCDTTPKQD  600
IPIWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-831733042133Protein ETHYLENE INSENSITIVE 3
4zds_B2e-831733042133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1380385TRKRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079068.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ76DI30.0Q76DI3_SOLLC; EIN3-like protein
STRINGSolyc06g073730.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein